제품 > 항체 > 다중클론항체(pAb)

MYCT1 Rabbit pAb (A14541)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using MYCT1 Rabbit pAb (A14541) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - MYCT1 Rabbit pAb (A14541)

Immunofluorescence analysis of C6 cells using MYCT1 Rabbit pAb (A14541) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using MYCT1 Rabbit pAb (A14541) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	MYCT1 Rabbit pAb
Catalog No.	A14541
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to act upstream of or within hematopoietic stem cell homeostasis. Located in nucleoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 99-235 of human MYCT1 (NP_079383.2).
Sequence	ASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS
Gene ID
Swiss Prot
Synonyms	MTLC; MYCT1
Calculated MW	27kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat spleen, Rat lung
Cellular location	Nucleus
Customer validation	WB(Other)