제품 > 항체 > 다중클론항체(pAb)

MYH6/α-MHC Rabbit pAb (A9516)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from mouse skeletal muscle, using MYH6/α-MHC Rabbit pAb (A9516).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - MYH6/α-MHC Rabbit pAb (A9516)

Immunofluorescence analysis of mouse heart using MYH6/α-MHC Rabbit pAb (A9516) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of rat heart using MYH6/α-MHC Rabbit pAb (A9516) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	MYH6/α-MHC Rabbit pAb
Catalog No.	A9516
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human MYH6/α-MHC (NP_002462.2).
Sequence	MTDAQMADFGAAAQYLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIR
Gene ID
Swiss Prot
Synonyms	ASD3; MYHC; SSS3; CMH14; MYHCA; CMD1EE; alpha-MHC; MYH6/α-MHC
Calculated MW	224kDa
Observed MW	255kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse skeletal muscle
Cellular location	Cytoplasm, myofibril
Customer validation	WB(Mus musculus) IF(Mus musculus, Oryctolagus cuniculus) IHC(Mus musculus)