제품 > 항체 > 다중클론항체(pAb)

MYL12A Rabbit pAb (A9176)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using MYL12A Rabbit pAb (A9176) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	MYL12A Rabbit pAb
Catalog No.	A9176
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 92-171 of human MYL12A (NP_006462.1).
Sequence	KLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Gene ID
Swiss Prot
Synonyms	MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24; MYL12A
Calculated MW	20kDa
Observed MW	18kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	LO2, A375, HeLa, K-562, Jurkat
Cellular location	cytoplasm, cytosol, extracellular exosome, Z disc
Customer validation	WB(Mus musculus, Homo sapiens)