제품 > 항체 > 다중클론항체(pAb)

MYOC Rabbit pAb (A1589)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using MYOC antibody (A1589) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	MYOC Rabbit pAb
Catalog No.	A1589
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 245-504 of human MYOC (NP_000252.1).
Sequence	CGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDIKLSKM
Gene ID
Swiss Prot
Synonyms	GPOA; JOAG; TIGR; GLC1A; JOAG1
Calculated MW	57kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Raji, U-937, BT-474, Mouse brain
Cellular location	Cell projection, Cytoplasmic vesicle, Endoplasmic reticulum, Golgi apparatus, Mitochondrion, Mitochondrion inner membrane, Mitochondrion intermembrane space, Mitochondrion outer membrane, Rough endoplasmic reticulum, Secreted, cilium, exosome, extracellular matrix, extracellular space
Customer validation	WB(Homo sapiens, Mus musculus)