제품 > 항체 > 단일클론항체(mAb)

Meckelin Rabbit mAb (A21162)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Meckelin Rabbit mAb (A21162) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from PC-12 cells, using Meckelin Rabbit mAb (A21162) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Meckelin Rabbit mAb (A21162)

Immunohistochemistry analysis of Meckelin in paraffin-embedded mouse kidney tissue using Meckelin Rabbit mAb (A21162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Meckelin in paraffin-embedded human liver tissue using Meckelin Rabbit mAb (A21162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Meckelin in paraffin-embedded rat kidney tissue using Meckelin Rabbit mAb (A21162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Meckelin Rabbit mAb
Catalog No.	A21162
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3051

Background

The protein encoded by this gene localizes to the primary cilium and to the plasma membrane. The gene functions in centriole migration to the apical membrane and formation of the primary cilium. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Meckel syndrome type 3 (MKS3) and Joubert syndrome type 6 (JBTS6).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 800-880 of human Meckelin (NP_714915.3).
Sequence	TNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMRQHYDRIHETLIRKNGPARLLSSSASTFEQSIKAYHMMNKF
Gene ID
Swiss Prot
Synonyms	MKS3; JBTS6; NPHP11; TNEM67; MECKELIN; Meckelin
Calculated MW	112kDa
Observed MW	112kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	PC-12, 293T, U-87MG, T47D, Jurkat, mESCs, Mouse brain
Cellular location	Cell membrane, Cytoplasm, Endoplasmic reticulum membrane, Multi-pass membrane protein, cilium basal body, cytoskeleton