Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Product name | Med25 Rabbit pAb |
---|---|
Catalog No. | A21274 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana Med25 (NP_173925.3). |
---|---|
Sequence | AGKPNQQSADLSIDTAKNTFYLVLISENFVEACAALSHSATNLPQTQSPVKVDRATVAPSIPVTGQPPAPVSSANGPIQNRQPVSVGPVPTATVKVEPSTV |
Gene ID | |
Swiss Prot | |
Synonyms | F2J7.4; F2J7_4; MED25; mediator 25; PHYTOCHROME AND FLOWERING TIME 1; Med25 |
Calculated MW | 90kDa |
Observed MW | 75kDa |
Reactivity | Arabidopsis thaliana |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Seedling, Inflorescences, Before inflorescence, Rosette leaf |
Cellular location | nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.