제품 > 항체 > 단일클론항체(mAb)

Melan-A/MART-1 Rabbit mAb (A22259)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using Melan-A/MART-1 Rabbit mAb (A22259) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Melan-A/MART-1 Rabbit mAb (A22259)

Immunofluorescence analysis of SK-MEL-28 cells using Melan-A/MART-1 Rabbit mAb (A22259) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Melan-A/MART-1 Rabbit mAb
Catalog No.	A22259
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55924

Background

Located in endoplasmic reticulum membrane; melanosome; and trans-Golgi network.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 11-110 of human MLANA (NP_005502.1).
Sequence	VLLLIGCWYCRRRNGYRALMDKSLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP
Gene ID
Swiss Prot
Synonyms	MART1; MART-1; Melan-A/MART-1
Calculated MW	13kDa
Observed MW	20kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	SK-MEL-28
Cellular location	Endoplasmic reticulum membrane, Golgi apparatus, Melanosome, Single-pass type III membrane protein, trans-Golgi network membrane