제품 > 항체 > 다중클론항체(pAb)

Mitofusin 2 Rabbit pAb (A13606)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Mitofusin 2 Rabbit pAb (A13606) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Mitofusin 2 Rabbit pAb (A13606)

Immunohistochemistry analysis of paraffin-embedded mouse liver using Mitofusin 2 Rabbit pAb (A13606) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver damage using Mitofusin 2 Rabbit pAb (A13606) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human esophagus using Mitofusin 2 Rabbit pAb (A13606) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	Mitofusin 2 Rabbit pAb
Catalog No.	A13606
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable several functions, including GTP binding activity; GTPase activity; and enzyme binding activity. Involved in mitochondrial fusion; parkin-mediated stimulation of mitophagy in response to mitochondrial depolarization; and positive regulation of cold-induced thermogenesis. Acts upstream of or within blastocyst formation and camera-type eye morphogenesis. Located in microtubule cytoskeleton and mitochondrion. Is expressed in several structures, including brain; early conceptus; eye; heart; and oocyte. Used to study Charcot-Marie-Tooth disease type 2A2A. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease; Charcot-Marie-Tooth disease type 2A2A; Charcot-Marie-Tooth disease type 2A2B; and Charcot-Marie-Tooth disease type 6. Orthologous to human MFN2 (mitofusin 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 70-260 of mouse Mitofusin 2 (NP_573464.2).
Sequence	TTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDKVLPSGIGHTTNCFLRVGGTDGHEAFLLTEGSEEKKSVKTVNQLAHALHQDEQLHAGSMVSVMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKQFFHKVSERLSRPNIFILNNRW
Gene ID
Swiss Prot
Synonyms	Fzo; D630023P19Rik; Mitofusin 2
Calculated MW	68kDa/86kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse heart, Rat heart
Cellular location	Mitochondrion outer membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens, Anser cygnoides, Mus musculus)