제품 > 항체 > 다중클론항체(pAb)

Moesin Rabbit pAb (A12473)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Moesin antibody (A12473) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunofluorescence - Moesin Rabbit pAb (A12473)

Immunofluorescence analysis of C6 cells using Moesin Rabbit pAb (A12473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using Moesin Rabbit pAb (A12473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using Moesin Rabbit pAb (A12473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Moesin Rabbit pAb
Catalog No.	A12473
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Moesin (for membrane-organizing extension spike protein) is a member of the ERM family which includes ezrin and radixin. ERM proteins appear to function as cross-linkers between plasma membranes and actin-based cytoskeletons. Moesin is localized to filopodia and other membranous protrusions that are important for cell-cell recognition and signaling and for cell movement.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 458-557 of human Moesin (NP_002435.1).
Sequence	KTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYK
Gene ID
Swiss Prot
Synonyms	HEL70; IMD50
Calculated MW	68kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Jurkat, HepG2, DU145, HT-1080, NIH/3T3, Mouse thymus, Mouse lung, Rat lung
Cellular location	Apical cell membrane, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, microvillus membrane