Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Monkeypox virus
Western blot analysis of recombinant Monkeypox virus (MPXV) E8L protein, using Monkeypox virus (MPXV) E8L Rabbit mAb (A23087) at 1:5000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 10ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
| Product name | Monkeypox virus (MPXV) E8L Rabbit mAb |
|---|---|
| Catalog No. | A23087 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC59811 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human Monkeypox virus (MPXV) E8L. (NP_536532.1). |
|---|---|
| Sequence | MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | |
| Calculated MW | 35kDa |
| Observed MW | 40-50kDa |
| Reactivity | Monkeypox virus |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | E8L recombinant protein |
| Cellular location | |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23087? Please let us know so that we can cite the reference in this datasheet.
