제품 > 항체 > 다중클론항체(pAb)

Mouse PlGF Rabbit pAb (A24547)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse heart, using Mouse PlGF Rabbit pAb (A24547) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	Mouse PlGF Rabbit pAb
Catalog No.	A24547
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable identical protein binding activity; receptor ligand activity; and vascular endothelial growth factor receptor binding activity. Acts upstream of or within branching involved in ureteric bud morphogenesis and regulation of morphogenesis of a branching structure. Located in extracellular space. Is expressed in several structures, including brain; gut gland; musculature; reproductive system; and urinary system. Human ortholog(s) of this gene implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Orthologous to human PGF (placental growth factor).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-158 of mouse PlGF (NP_032853.1).
Sequence	ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Gene ID
Swiss Prot
Synonyms	PIGF; Plgf; Mouse PlGF
Calculated MW	17kDa
Observed MW	22kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse heart
Cellular location