제품 > 항체 > 다중클론항체(pAb)

Mrpl18 Rabbit pAb (A18186)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Mrpl18 Rabbit pAb (A18186) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	Mrpl18 Rabbit pAb
Catalog No.	A18186
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable 5S rRNA binding activity. Predicted to be involved in rRNA import into mitochondrion. Located in mitochondrion. Is expressed in several structures, including brain; connective tissue; early conceptus; genitourinary system; and gut. Orthologous to human MRPL18 (mitochondrial ribosomal protein L18).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 42-180 of mouse Mrpl18 (NP_080586.1).
Sequence	EAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE
Gene ID
Swiss Prot
Synonyms	HSPC071; MRP-L18; 1010001C05Rik; Mrpl18
Calculated MW	21kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, MCF7, Mouse kidney, Mouse brain, Mouse liver
Cellular location	mitochondrial inner membrane, mitochondrion