제품 > 항체 > 다중클론항체(pAb)

Mrpl55 Rabbit pAb (A18244)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Mrpl55 Rabbit pAb (A18244) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	Mrpl55 Rabbit pAb
Catalog No.	A18244
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Located in mitochondrion. Is expressed in several structures, including early conceptus; gonad; heart; liver; and metanephros. Orthologous to human MRPL55 (mitochondrial ribosomal protein L55).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 33-127 of mouse Mrpl55 (NP_001289265.1).
Sequence	DCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK
Gene ID
Swiss Prot
Synonyms	L55mt; MRP-L55; 2810038N09Rik; Mrpl55
Calculated MW	15kDa
Observed MW	13-14kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, MCF7, Mouse testis
Cellular location	mitochondrial inner membrane, mitochondrion