Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Musashi-2 (Musashi-2 (MSI2)) Rabbit mAb (A19814) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded rat brain using Musashi-2 (Musashi-2 (MSI2)) Rabbit mAb (A19814) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Product name | Musashi-2 (MSI2) Rabbit mAb |
|---|---|
| Catalog No. | A19814 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2341 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Musashi-2 (MSI2) (Q96DH6). |
|---|---|
| Sequence | ARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MSI2H; Musashi-2 (MSI2) |
| Calculated MW | 35kDa |
| Observed MW | 36kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HeLa, HT-29, PC-12, MCF7, Mouse brain, Rat brain |
| Cellular location | cytoplasm, cytosol |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
