제품 > 항체 > 다중클론항체(pAb)

N6AMT1/HEMK2 Rabbit pAb (A21784)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using N6AMT1 Rabbit pAb (A21784) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer:3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: Q120s.

ABclonal:Immunohistochemistry - N6AMT1/HEMK2 Rabbit pAb (A21784)

Immunohistochemistry analysis of N6AMT1/HEMK2 in paraffin-embedded human thyroid cancer tissue using N6AMT1/HEMK2 Rabbit pAb (A21784) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	N6AMT1/HEMK2 Rabbit pAb
Catalog No.	A21784
Host species	rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an N(6)-adenine-specific DNA methyltransferase. The encoded enzyme may be involved in the methylation of release factor I during translation termination. This enzyme is also involved in converting the arsenic metabolite monomethylarsonous acid to the less toxic dimethylarsonic acid. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 11.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-214 of human N6AMT1/HEMK2 (NP_037372.4).
Sequence	MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Gene ID
Swiss Prot
Synonyms	KMT9; MTQ2; PrmC; HEMK2; N6AMT; PRED28; C21orf127; m.HsaHemK2P; N6AMT1/HEMK2
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U2OS, Mouse ovary
Cellular location	cytosol, nucleus