제품 > 항체 > 단일클론항체(mAb)

NCF4/p40-phox Rabbit mAb (A0935)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from THP-1 cells, using NCF4/p40-phox Rabbit mAb (A0935) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Mouse thymus, using NCF4/p40-phox Rabbit mAb (A0935) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - NCF4/p40-phox Rabbit mAb (A0935)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using NCF4/p40-phox Rabbit mAb (A0935) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - NCF4/p40-phox Rabbit mAb (A0935)

Immunoprecipitation analysis of 300 μg extracts of THP-1 cells using 3 μg NCF4/p40-phox antibody (A0935). Western blot was performed from the immunoprecipitate using NCF4/p40-phox antibody (A0935) at a dilution of 1:1000.

Overview

Product name	NCF4/p40-phox Rabbit mAb
Catalog No.	A0935
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2553

Background

The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 240-339 of human NCF4/p40-phox (Q15080).
Sequence	LRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
Gene ID
Swiss Prot
Synonyms	NCF; CGD3; P40PHOX; SH3PXD4; NCF4/p40-phox
Calculated MW	39kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	THP-1, Mouse thymus
Cellular location	Cytoplasm, Cytoplasmic side, Endosome membrane, Membrane, Peripheral membrane protein, cytosol