제품 > 항체 > 단일클론항체(mAb)

NCK1 Rabbit mAb (A9129)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NCK11 Rabbit mAb (A9129) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - NCK1 Rabbit mAb (A9129)

Immunohistochemistry analysis of paraffin-embedded Rat testis using NCK11 Rabbit mAb (A9129) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - NCK1 Rabbit mAb (A9129)

Immunofluorescence analysis of NIH-3T3 cells using NCK11 Rabbit mAb (A9129) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	NCK1 Rabbit mAb
Catalog No.	A9129
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1441

Background

The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Alternatively spliced transcript variants encoding different isoforms have been found.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NCK11 (P16333).
Sequence	PFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
Gene ID
Swiss Prot
Synonyms	NCK; nck-1; NCKalpha; NCK1
Calculated MW	43kDa
Observed MW	47kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, 293T, Mouse lung, Mouse brain, Rat brain
Cellular location	Cytoplasm, Endoplasmic reticulum, Nucleus
Customer validation	IF(Mus musculus)