제품 > 항체 > 단일클론항체(mAb)

NDUFAB1 Rabbit mAb (A21114)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NDUFAB1 Rabbit mAb (A21114) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - NDUFAB1 Rabbit mAb (A21114)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using NDUFAB1 Rabbit mAb (A21114) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver using NDUFAB1 Rabbit mAb (A21114) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	NDUFAB1 Rabbit mAb
Catalog No.	A21114
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3068

Background

Predicted to enable acyl binding activity; acyl carrier activity; and fatty acid binding activity. Involved in mitochondrial respiratory chain complex I assembly and protein lipoylation. Located in mitochondrion and nucleoplasm. Part of mitochondrial respiratory chain complex I. Colocalizes with mitochondrial large ribosomal subunit.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-156 of human NDUFAB1 (NP_004994.1).
Sequence	PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Gene ID
Swiss Prot
Synonyms	ACP; ACP1; SDAP; FASN2A; NDUFAB1
Calculated MW	17kDa
Observed MW	10kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Hep G2, A-431, 293T, Mouse kidney, Mouse stomach, Mouse heart, Rat skeletal muscle, Rat heart
Cellular location	Mitochondrion
Customer validation	WB(Mus musculus)