제품 > 항체 > 다중클론항체(pAb)

NDUFB10 Rabbit pAb (A3982)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NDUFB10 Rabbit pAb (A3982) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - NDUFB10 Rabbit pAb (A3982)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells, using 3 μg NDUFB10 antibody (A3982). Western blot was performed from the immunoprecipitate using NDUFB10 antibody (A3982) at a dilution of 1:1000.

Review

Overview

Product name	NDUFB10 Rabbit pAb
Catalog No.	A3982
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrial inner membrane. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency 35.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human NDUFB10 (NP_004539.1).
Sequence	MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
Gene ID
Swiss Prot
Synonyms	PDSW; MC1DN35; NDUFB10
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HepG2, HeLa, MCF-7, Jurkat, Mouse brain, Mouse kidney, Mouse heart
Cellular location	Matrix side, Mitochondrion inner membrane, Peripheral membrane protein
Customer validation	(C2C12) WB(Mus musculus)