제품 > 항체 > 다중클론항체(pAb)

NDUFB1 Rabbit pAb (A16925)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using NDUFB1 Rabbit pAb (A16925) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - NDUFB1 Rabbit pAb (A16925)

Immunofluorescence analysis of L929 cells using NDUFB1 Rabbit pAb (A16925) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	NDUFB1 Rabbit pAb
Catalog No.	A16925
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion and nuclear speck. Part of mitochondrial respiratory chain complex I.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human NDUFB1 (NP_004536.2).
Sequence	MICWRHPSAPCGRGEWQVPRSQLPLARVEFPVALGLGVAVGAEAAAIMVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
Gene ID
Swiss Prot
Synonyms	MNLL; CI-MNLL; CI-SGDH; NDUFB1
Calculated MW	7kDa
Observed MW	11kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, A375, Mouse brain, Mouse pancreas
Cellular location	mitochondrial inner membrane, mitochondrial respiratory chain complex I, mitochondrion, nuclear speck