제품 > 항체 > 단일클론항체(mAb)

NDUFC2 Rabbit mAb (A21116)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using NDUFC2 Rabbit mAb (A21116) at1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	NDUFC2 Rabbit mAb
Catalog No.	A21116
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3020

Background

Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human NDUFC2 (NP_004540.1).
Sequence	MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR
Gene ID
Swiss Prot
Synonyms	HLC-1; B14.5b; MC1DN36; NADHDH2; CI-B14.5b; NDUFC2
Calculated MW	14kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500-1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, A-549
Cellular location	Matrix side, Mitochondrion inner membrane, Single-pass membrane protein