제품 > 항체 > 단일클론항체(mAb)

NDUFS1 Rabbit mAb (A21192)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NDUFS1 Rabbit mAb (A21192) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - NDUFS1 Rabbit mAb (A21192)

Immunohistochemistry analysis of NDUFS1 in paraffin-embedded human colon tissue using NDUFS1 Rabbit mAb (A21192) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of NDUFS1 in paraffin-embedded human liver cancer tissue using NDUFS1 Rabbit mAb (A21192) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of NDUFS1 in paraffin-embedded human liver tissue using NDUFS1 Rabbit mAb (A21192) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of NDUFS1 in paraffin-embedded Human lung adenocarcinoma tissue using NDUFS1 Rabbit mAb (A21192) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of NDUFS1 in paraffin-embedded mouse kidney tissue using NDUFS1 Rabbit mAb (A21192) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of NDUFS1 in paraffin-embedded rat kidney tissue using NDUFS1 Rabbit mAb (A21192) at a dilution of 1:400 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	NDUFS1 Rabbit mAb
Catalog No.	A21192
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52613

Background

The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 80-290 of human NDUFS1 (NP_004997.4).
Sequence	VEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKT
Gene ID
Swiss Prot
Synonyms	CI-75k; MC1DN5; CI-75Kd; PRO1304; NDUFS1
Calculated MW	79kDa
Observed MW	75kDa/79kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Raji, HeLa, Mouse heart, Mouse skeletal muscle, Rat heart
Cellular location	Mitochondrion inner membrane
Customer validation	WB(Homo sapiens)