제품 > 항체 > 다중클론항체(pAb)

NDUFS4 Rabbit pAb (A13519)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NDUFS4 Rabbit pAb (A13519) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - NDUFS4 Rabbit pAb (A13519)

Immunohistochemistry analysis of paraffin-embedded rat kidney using NDUFS4 Rabbit pAb (A13519) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - NDUFS4 Rabbit pAb (A13519)

Immunofluorescence analysis of U2OS cells using NDUFS4 Rabbit pAb (A13519). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	NDUFS4 Rabbit pAb
Catalog No.	A13519
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-175 of human NDUFS4 (NP_002486.1).
Sequence	MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Gene ID
Swiss Prot
Synonyms	AQDQ; CI-18; MC1DN1; CI-AQDQ; CI-18 kDa; NDUFS4
Calculated MW	20kDa
Observed MW	20kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	MCF7, HepG2, 293T, Mouse brain, Mouse bone marrow, Mouse liver, Rat brain, Rat liver
Cellular location	Matrix side, Mitochondrion inner membrane, Peripheral membrane protein
Customer validation	WB(Homo sapiens, Mus musculus, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

NDUFS4 Rabbit pAb images

Western blot - NDUFS4 Rabbit pAb (A13519)

Immunohistochemistry - NDUFS4 Rabbit pAb (A13519)

Immunofluorescence - NDUFS4 Rabbit pAb (A13519)

Immunofluorescence analysis of U2OS cells using NDUFS4 Rabbit pAb (A13519). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.