제품 > 항체 > 다중클론항체(pAb)

NEDD1 Rabbit pAb (A5128)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using NEDD1 antibody (A5128) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - NEDD1 Rabbit pAb (A5128)

Immunofluorescence analysis of L929 cells using NEDD1 antibody (A5128) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	NEDD1 Rabbit pAb
Catalog No.	A5128
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in protein localization to centrosome. Located in centrosome; nucleoplasm; and plasma membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 411-660 of human NEDD1 (NP_690869.1).
Sequence	SPIRDDAVVNKGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLTAESKKIYMGKQESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVTAGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF
Gene ID
Swiss Prot
Synonyms	GCP-WD; TUBGCP7
Calculated MW	72kDa
Observed MW	78kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, Jurkat, mouse brain, rat brain
Cellular location	Cytoplasm, centrosome, cytoskeleton, microtubule organizing center