제품 > 항체 > 단일클론항체(mAb)

NFRKB Rabbit mAb (A23915)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from 293T cells, using NFRKB Rabbit mAb (A23915) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Overview

Product name	NFRKB Rabbit mAb
Catalog No.	A23915
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62365

Background

Enables protease binding activity. Predicted to be involved in DNA recombination and DNA repair. Located in nucleoplasm. Colocalizes with Ino80 complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 370-495 of human NFRKB (NP_001137307.1).
Sequence	LGINEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSS
Gene ID
Swiss Prot
Synonyms	INO80G; NFRKB
Calculated MW	139kDa
Observed MW	175kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T
Cellular location	Nucleus.