제품 > 항체 > 다중클론항체(pAb)

NGDN Rabbit pAb (A14509)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using NGDN Rabbit pAb (A14509) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	NGDN Rabbit pAb
Catalog No.	A14509
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Neuroguidin is an EIF4E (MIM 133440)-binding protein that interacts with CPEB (MIM 607342) and functions as a translational regulatory protein during development of the vertebrate nervous system (Jung et al., 2006 [PubMed 16705177]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 61-209 of human NGDN (NP_001036100.1).
Sequence	LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL
Gene ID
Swiss Prot
Synonyms	NGD; LCP5; CANu1; lpd-2; C14orf120; NGDN
Calculated MW	36kDa
Observed MW	Refer to Figures

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples
Cellular location	Cell projection, Chromosome, Cytoplasm, Nucleus, axon, centromere, dendrite, filopodium, nucleolus