제품 > 항체 > 다중클론항체(pAb)

NGFRAP1 Rabbit pAb (A7296)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using NGFRAP1 Antibody (A7296) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - NGFRAP1 Rabbit pAb (A7296)

Immunofluorescence analysis of MCF-7 cells using NGFRAP1 antibody (A7296).

Overview

Product name	NGFRAP1 Rabbit pAb
Catalog No.	A7296
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables identical protein binding activity. Predicted to be involved in signal transduction. Predicted to act upstream of or within extrinsic apoptotic signaling pathway via death domain receptors. Located in cytosol.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human NGFRAP1 (NP_996798.1).
Sequence	MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
Gene ID
Swiss Prot
Synonyms	Bex; NADE; HGR74; NGFRAP1; DXS6984E
Calculated MW	13kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	BT-474, MCF7, Mouse liver
Cellular location	Cytoplasm, Nucleus