제품 > 항체 > 다중클론항체(pAb)

NLGN4Y Rabbit pAb (A4513)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NLGN4Y Rabbit pAb (A4513) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - NLGN4Y Rabbit pAb (A4513)

Immunohistochemistry analysis of paraffin-embedded Human prostate using NLGN4Y Rabbit pAb (A4513) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	NLGN4Y Rabbit pAb
Catalog No.	A4513
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 122-256 of human NLGN4Y (NP_001157710.1).
Sequence	DMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF
Gene ID
Swiss Prot
Synonyms	HNL4Y; NLGN4Y
Calculated MW	92kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-87MG, U-251MG, HeLa, A-549, Mouse brain, Mouse testis, Rat brain, Rat testis
Cellular location	Cell junction, Cell membrane, Single-pass type I membrane protein, postsynaptic cell membrane, postsynaptic density, synapse
Customer validation	WB(Homo sapiens, Mus musculus)