Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | NLRP3 Rabbit mAb |
---|---|
Catalog No. | A24294 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC62768 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse NLRP3(NP_665826.1). |
---|---|
Sequence | MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDR |
Gene ID | |
Swiss Prot | |
Synonyms | FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; NLRP3 |
Calculated MW | 118kDa |
Observed MW | 110kDa//110KD |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | RAW 264.7 treated by LPS |
Cellular location | Cytoplasm, cytosol, endoplasmic reticulum, extracellular region, inflammasome complex, NLRP3 inflammasome complex, nucleus. |
Customer validation | WB(Cyprinus carpio, Mus musculus, Rattus norvegicus, Other, Homo sapiens) IF(Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24294? Please let us know so that we can cite the reference in this datasheet.