Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NLRP3 Rabbit pAb |
---|---|
Catalog No. | A21906 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of mouse NLRP3 (NP_665826.1). |
---|---|
Sequence | MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWN |
Gene ID | |
Swiss Prot | |
Synonyms | FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; NLRP3 |
Calculated MW | 118kDa |
Observed MW | 110kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | RAW 264.7 treated by LPS |
Cellular location | cytoplasm, cytosol, endoplasmic reticulum, extracellular region, inflammasome complex, NLRP3 inflammasome complex, nucleus |
Customer validation | IHC(Mus musculus, Rattus norvegicus, Homo sapiens) WB(Mus musculus, Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21906? Please let us know so that we can cite the reference in this datasheet.