제품 > 항체 > 단일클론항체(mAb)

NME2/NM23B Rabbit mAb (A5621)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various lysates, using NME2/NM23B Rabbit mAb (A5621) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	NME2/NM23B Rabbit mAb
Catalog No.	A5621
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1412

Background

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-152 of human NME2/NM23B (P22392).
Sequence	QHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Gene ID
Swiss Prot
Synonyms	PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2
Calculated MW	17kDa
Observed MW	17kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat kidney, Rat heart
Cellular location	Cell projection, Cytoplasm, Nucleus, Lamellipodium, Ruffle