제품 > 항체 > 다중클론항체(pAb)

NME2/NM23B Rabbit pAb (A7443)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NME2/NM23B Rabbit pAb (A7443) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - NME2/NM23B Rabbit pAb (A7443)

Immunohistochemistry analysis of paraffin-embedded Human kidney using NME2/NM23B Rabbit pAb (A7443) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using NME2/NM23B Rabbit pAb (A7443) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	NME2/NM23B Rabbit pAb
Catalog No.	A7443
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human NME2/NM23B (NP_001018148.1).
Sequence	MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Gene ID
Swiss Prot
Synonyms	PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2; NME2/NM23B
Calculated MW	17kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	PC-12, 22Rv1, Mouse kidney, Mouse liver, Rat liver
Cellular location	Cell projection, Cytoplasm, Nucleus, lamellipodium, ruffle
Customer validation	WB(Homo sapiens)