제품 > 항체 > 다중클론항체(pAb)

NMUR2 Rabbit pAb (A12812)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using NMUR2 Rabbit pAb (A12812) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	NMUR2 Rabbit pAb
Catalog No.	A12812
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the regulation of food intake and body weight.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 326-415 of human NMUR2 (NP_064552.3).
Sequence	IYNLLSRRFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPAALSSEQMSRTNYQSFHFNKT
Gene ID
Swiss Prot
Synonyms	FM4; FM-4; TGR1; NMU2R; TGR-1; NMU-R2; NMUR2
Calculated MW	48kDa
Observed MW	48kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SGC-7901, Mouse uterus, Mouse small intestine, Rat uterus
Cellular location	Cell membrane, Multi-pass membrane protein