제품 > 항체 > 다중클론항체(pAb)

NOLC1 Rabbit pAb (A5899)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using NOLC1 antibody (A5899) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - NOLC1 Rabbit pAb (A5899)

Immunofluorescence analysis of U-2 OS cells using NOLC1 antibody (A5899) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	NOLC1 Rabbit pAb
Catalog No.	A5899
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables protein heterodimerization activity and protein-macromolecule adaptor activity. Involved in neural crest cell development; neural crest formation; and regulation of translation. Located in fibrillar center.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 400-699 of human NOLC1 (NP_004732.2).
Sequence	VKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE
Gene ID
Swiss Prot
Synonyms	P130; Srp40; NOPP130; NOPP140; NS5ATP13
Calculated MW	74kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A-549, HeLa, HepG2, MCF7
Cellular location	Cytoplasm, Nucleus, nucleolus
Customer validation	WB(Mus musculus) IF(Homo sapiens) Co-IP(Mus musculus)