제품 > 항체 > 다중클론항체(pAb)

NPHS2 Rabbit pAb (A17337)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using NPHS2 Rabbit pAb (A17337) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Overview

Product name	NPHS2 Rabbit pAb
Catalog No.	A17337
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-388 of human NPHS2 (NP_055440.1).
Sequence	AASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML
Gene ID
Swiss Prot
Synonyms	PDCN; SRN1; NPHS2
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	NTERA-2, Rat spleen
Cellular location	cell-cell junction, cytoplasmic side of plasma membrane, endoplasmic reticulum, extracellular exosome, plasma membrane, slit diaphragm.