제품 > 항체 > 단일클론항체(mAb)

NPY5R Rabbit mAb (A9359)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using (A9359) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

ABclonal:Immunofluorescence - NPY5R Rabbit mAb (A9359)

Immunofluorescence analysis of Neuro-2a cells using NPY5R Rabbit mAb (A9359) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of SH-SY5Y cells using NPY5R Rabbit mAb (A9359) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	NPY5R Rabbit mAb
Catalog No.	A9359
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2758

Background

The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved in a pathway that protects neuroblastoma cells from chemotherapy-induced cell death, providing a possible therapeutic target against neuroblastoma. Three transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NPY5R (Q15761).
Sequence	MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLT
Gene ID
Swiss Prot
Synonyms	NPYR5; NPY5-R; NPYY5-R
Calculated MW	51kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	DU 145, K-562, SH-SY5Y, Mouse brain, Mouse eye, Rat spinal cord, Rat brain
Cellular location	Cytoplasm, GABA-ergic synapse, Neuron projection, Plasma membrane, Presynapse