Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NRF1 Rabbit mAb |
---|---|
Catalog No. | A3252 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0768 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656). |
---|---|
Sequence | LVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGA |
Gene ID | |
Swiss Prot | |
Synonyms | ALPHA-PAL; NRF1 |
Calculated MW | 54kDa |
Observed MW | 68kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | NIH/3T3, Mouse lung, Rat testis, HeLa, 293T, HepG2 |
Cellular location | Nucleus. |
Customer validation | WB(Mus musculus, Gallus gallus, Bos taurus, Homo sapiens, Arabidopsis thaliana) IHC(Homo sapiens) ChIP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3252? Please let us know so that we can cite the reference in this datasheet.