제품 > 항체 > 다중클론항체(pAb)

NUBP1 Rabbit pAb (A16403)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HepG2 cells, using NUBP1 Rabbit pAb (A16403) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - NUBP1 Rabbit pAb (A16403)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using NUBP1 Rabbit pAb (A16403) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	NUBP1 Rabbit pAb
Catalog No.	A16403
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2).
Sequence	PQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Gene ID
Swiss Prot
Synonyms	NBP; NBP1; CIAO5; NBP35; NUBP1
Calculated MW	35kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2
Cellular location	Cell projection, Cytoplasm, Nucleus, centriole, centrosome, cilium axoneme, cilium basal body, cytoskeleton, microtubule organizing center