제품 > 항체 > 다중클론항체(pAb)

NUBP1 Rabbit pAb (A16404)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using NUBP1 Rabbit pAb (A16404) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	NUBP1 Rabbit pAb
Catalog No.	A16404
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 201-320 of human NUBP1 (NP_002475.2).
Sequence	PQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Gene ID
Swiss Prot
Synonyms	NBP; NBP1; CIAO5; NBP35; NUBP1
Calculated MW	35kDa
Observed MW	35kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver, Mouse kidney
Cellular location	Cell projection, Cytoplasm, Nucleus, centriole, centrosome, cilium axoneme, cilium basal body, cytoskeleton, microtubule organizing center