제품 > 항체 > 단일클론항체(mAb)

NUDT5 Rabbit mAb (A0609)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using NUDT5 antibody (A0609) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunofluorescence - NUDT5 Rabbit mAb (A0609)

Immunofluorescence analysis of HepG2 cells using NUDT5 Rabbit mAb (A0609) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	NUDT5 Rabbit mAb
Catalog No.	A0609
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2525

Background

This gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDT5 (Q9UKK9).
Sequence	MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLID
Gene ID
Swiss Prot
Synonyms	YSA1; YSA1H; YSAH1; hNUDT5
Calculated MW	24kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HepG2, A-431, Mouse thymus, Mouse liver, Rat kidney
Cellular location	Cytosol, Extracellular Exosome, Nucleus