Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using NUMA11 Rabbit mAb (A4416) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded human spleen tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded human thyroid cancer tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded mouse intestin tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded mouse liver tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded mouse lung tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded mouse spleen tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded mouse testis tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded rat brain tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of NUMA1 in paraffin-embedded rat colon tissue using NUMA1 Rabbit mAb (A4416) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | NUMA1 Rabbit mAb |
|---|---|
| Catalog No. | A4416 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1000 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2000-2100 of human NUMA11 (Q14980). |
|---|---|
| Sequence | TPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NUMA; NMP-22 |
| Calculated MW | 238kDa |
| Observed MW | 250kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | A-549, Mouse lung |
| Cellular location | Chromosome, Cytoplasm, Nucleus matrix, cytoskeleton, spindle pole |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
