제품 > 항체 > 단일클론항체(mAb)

NUMB Rabbit mAb (A9039)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using NUMB Rabbit mAb (A9039) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunoprecipitation - NUMB Rabbit mAb (A9039)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg NUMB antibody (A9039). Western blot was performed from the immunoprecipitate using NUMB (A9039) at a dilution of 1:1000.

Overview

Product name	NUMB Rabbit mAb
Catalog No.	A9039
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1390

Background

The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUMB (P49757).
Sequence	MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDE
Gene ID
Swiss Prot
Synonyms	S171; C14orf41; c14_5527; NUMB
Calculated MW	71kDa
Observed MW	66kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, NIH/3T3
Cellular location	Basolateral plasma membrane, clathrin-coated pit, clathrin-coated vesicle, cytoplasm, early endosome, glutamatergic synapse, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학노치 신호전달 경로

NUMB Rabbit mAb images

Western blot - NUMB Rabbit mAb (A9039)

Immunoprecipitation - NUMB Rabbit mAb (A9039)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg NUMB antibody (A9039). Western blot was performed from the immunoprecipitate using NUMB (A9039) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.