제품 > 항체 > 다중클론항체(pAb)

NUP43 Rabbit pAb (A15983)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using NUP43 Rabbit pAb (A15983) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	NUP43 Rabbit pAb
Catalog No.	A15983
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human NUP43 (NP_942590.1).
Sequence	DGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAH
Gene ID
Swiss Prot
Synonyms	p42; bA350J20.1; NUP43
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	OVCAR3, HeLa, Rat spleen , Rat testis
Cellular location	Chromosome, Nucleus, centromere, kinetochore, nuclear pore complex