Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NUP93 Rabbit pAb |
---|---|
Catalog No. | A4333 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 670-819 of human NUP93 (NP_055484.3). |
---|---|
Sequence | IAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN |
Gene ID | |
Swiss Prot | |
Synonyms | NIC96; NUP93 |
Calculated MW | 93kDa |
Observed MW | 93kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG, A-431, LO2, HeLa, Mouse brain, Mouse heart, Mouse kidney, Mouse liver, Rat testis |
Cellular location | Nucleus, Nucleus membrane, Peripheral membrane protein, nuclear pore complex |
Customer validation | WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4333? Please let us know so that we can cite the reference in this datasheet.