Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of various lysates using NY-ESO-1 Rabbit mAb (A21229) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
| Product name | NY-ESO-1 Rabbit mAb |
|---|---|
| Catalog No. | A21229 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC52780 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NY-ESO-1 (P78358). |
|---|---|
| Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CTAG; ESO1; CT6.1; CTAG1; LAGE-2; LAGE2B; NY-ESO-1 |
| Calculated MW | 18kDa |
| Observed MW | 18kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HT-1080 |
| Cellular location | Cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
