Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | Niemann-Pick type C1 Like-1 Rabbit pAb |
---|---|
Catalog No. | A10049 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1030-1100 of human Niemann-Pick type C1 Like-1 (NP_001095118.1). |
---|---|
Sequence | AAYSTSVNLTSDGQVLASRFMAYHKPLKNSQDYTEALRAARELAANITADLRKVPGTDPAFEVFPYTITNV |
Gene ID | |
Swiss Prot | |
Synonyms | LDLCQ7; NPC11L1; SLC65A2; Niemann-Pick type C1 Like-1 |
Calculated MW | 149kDa |
Observed MW | 140kDa/150kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2 |
Cellular location | Apical cell membrane, Cell membrane, Cytoplasmic vesicle membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10049? Please let us know so that we can cite the reference in this datasheet.