Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Notch1 Rabbit mAb |
---|---|
Catalog No. | A19090 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0285 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (P46531). |
---|---|
Sequence | ILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK |
Gene ID | |
Swiss Prot | |
Synonyms | hN1; AOS5; TAN1; AOVD1; Notch1 |
Calculated MW | 273kDa |
Observed MW | 125kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | 293T, Jurkat, Mouse lung, Mouse brain |
Cellular location | Cell membrane, Nucleus, Single-pass type I membrane protein |
Customer validation | WB(Homo sapiens, Mus musculus, Ovis aries) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19090? Please let us know so that we can cite the reference in this datasheet.