Reviews (3)Publications (8) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Rat brain , using Notch1 Rabbit pAb (A7636) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates using Notch1 Rabbit pAb (A7636) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Rat ovary using Notch1 Rabbit pAb (A7636) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Notch1 Rabbit pAb (A7636) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of U2OS cells using Notch1 Rabbit pAb (A7636) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Notch1 Rabbit pAb (A7636) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of C6 cells using Notch1 Rabbit pAb (A7636) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using Notch1 Rabbit pAb (A7636) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using Notch1 Rabbit pAb (A7636) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Notch1 Rabbit pAb (A7636) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using Notch1 Rabbit pAb (A7636) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Notch1 Rabbit pAb |
|---|---|
| Catalog No. | A7636 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2456-2555 of human Notch1 (NP_060087.3). |
|---|---|
| Sequence | ILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | hN1; AOS5; TAN1; AOVD1; Notch1 |
| Calculated MW | 273kDa |
| Observed MW | 300kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, HepG2, Mouse lung, Mouse brain, Rat brain |
| Cellular location | Cell membrane, Nucleus, Single-pass type I membrane protein |
| Customer validation | (Human skin T cell lymphoma, HL60,Hut102) WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7636? Please let us know so that we can cite the reference in this datasheet.
