제품 > 항체 > 다중클론항체(pAb)

ADAM12 Rabbit pAb (A7940)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ADAM12 Rabbit pAb (A7940) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ADAM12 Rabbit pAb (A7940)

Immunohistochemistry analysis of paraffin-embedded Human placenta using ADAM12 Rabbit pAb (A7940) at dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ADAM12 Rabbit pAb (A7940)

Immunofluorescence analysis of C6 cells using ADAM12 Rabbit pAb (A7940) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using ADAM12 Rabbit pAb (A7940) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using ADAM12 Rabbit pAb (A7940) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	ADAM12 Rabbit pAb
Catalog No.	A7940
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of a family of proteins that are structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Expression of this gene has been used as a maternal serum marker for pre-natal development. Alternative splicing results in multiple transcript variants encoding different isoforms. Shorter isoforms are secreted, while longer isoforms are membrane-bound form.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2).
Sequence	ASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPGLVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQAEARQEAAESNRERGQGQEPVGSQEHASTASLTLI
Gene ID
Swiss Prot
Synonyms	MCMP; MLTN; CAR10; MLTNA; MCMPMltna; ADAM12-OT1; ADAM12
Calculated MW	100kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse brain, Mouse thymus, Mouse fat, Mouse ovary, Rat brain
Cellular location	Cell membrane, Secreted, Single-pass type I membrane protein
Customer validation	WB(Homo sapiens, Rattus norvegicus) IHC(Homo sapiens)