제품 > 항체 > 단일클론항체(mAb)

hnRNP K Rabbit mAb (A0772)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using hnRNP K antibody (A0772) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - hnRNP K Rabbit mAb (A0772)

Immunohistochemistry analysis of hnRNP K in paraffin-embedded human cervix cancer tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded human colon tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded Human lung adenocarcinoma tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded human tonsil tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse colon tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse liver tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse spleen tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse testis tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded rat colon tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of hnRNP K in paraffin-embedded rat spleen tissue using hnRNP K Rabbit mAb (A0772) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - hnRNP K Rabbit mAb (A0772)

Confocal imaging of U-2 0S cells using hnRNP K Rabbit mAb (A0772, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	hnRNP K Rabbit mAb
Catalog No.	A0772
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0512

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Several alternatively spliced transcript variants have been described for this gene, however, not all of them are fully characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978).
Sequence	METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
Gene ID
Swiss Prot
Synonyms	AUKS; CSBP; TUNP; HNRPK
Calculated MW	49kDa/51kDa
Observed MW	58-62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, NIH/3T3, PC-12, HepG2, Mouse brain, Rat brain
Cellular location	Cell projection, Cytoplasm, Nucleus, Nucleoplasm, Podosome